Anti-MTM1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MTM1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA010008
• Supplier Catalog Number: HPA010008
• Alternative Catalog Number: ATA-HPA010008-100,ATA-HPA010008-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MTM1

Product Description

myotubularin 1

Additional Information

Anti-MTM1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 4534
• UniProt: Q13496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MTM1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in subsets of cells in seminiferous ducts.

Immunohistochemical staining of human fallopian tube shows moderate to strong membranous positivity in subsets of glandular cells.

Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.

HPA010008

HPA010008

HPA010008