Anti-MTM1

Catalog Number: ATA-HPA010008
Article Name: Anti-MTM1
Biozol Catalog Number: ATA-HPA010008
Supplier Catalog Number: HPA010008
Alternative Catalog Number: ATA-HPA010008-100,ATA-HPA010008-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MTM1
myotubularin 1
Anti-MTM1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 4534
UniProt: Q13496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MTM1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in subsets of cells in seminiferous ducts.
Immunohistochemical staining of human fallopian tube shows moderate to strong membranous positivity in subsets of glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
HPA010008-100ul
HPA010008-100ul
HPA010008-100ul