Anti-ENDOD1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010517
Artikelname: Anti-ENDOD1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010517
Hersteller Artikelnummer: HPA010517
Alternativnummer: ATA-HPA010517-100,ATA-HPA010517-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0830
endonuclease domain containing 1
Anti-ENDOD1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23052
UniProt: O94919
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ENDOD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-ENDOD1 antibody. Corresponding ENDOD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, pancreas and prostate using Anti-ENDOD1 antibody HPA010517 (A) shows similar protein distribution across tissues to independent antibody HPA008932 (B).
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human liver using Anti-ENDOD1 antibody HPA010517.
Immunohistochemical staining of human cerebral cortex using Anti-ENDOD1 antibody HPA010517.
HPA010517
HPA010517
HPA010517