Anti-ENDOD1

Catalog Number: ATA-HPA010517
Article Name: Anti-ENDOD1
Biozol Catalog Number: ATA-HPA010517
Supplier Catalog Number: HPA010517
Alternative Catalog Number: ATA-HPA010517-100,ATA-HPA010517-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0830
endonuclease domain containing 1
Anti-ENDOD1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23052
UniProt: O94919
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ENDOD1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-ENDOD1 antibody. Corresponding ENDOD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, pancreas and prostate using Anti-ENDOD1 antibody HPA010517 (A) shows similar protein distribution across tissues to independent antibody HPA008932 (B).
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human liver using Anti-ENDOD1 antibody HPA010517.
Immunohistochemical staining of human cerebral cortex using Anti-ENDOD1 antibody HPA010517.
HPA010517-100ul
HPA010517-100ul
HPA010517-100ul