Anti-IL6ST
Artikelnummer:
ATA-HPA010558
- Bilder (8)
| Artikelname: | Anti-IL6ST |
| Artikelnummer: | ATA-HPA010558 |
| Hersteller Artikelnummer: | HPA010558 |
| Alternativnummer: | ATA-HPA010558-100,ATA-HPA010558-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD130, GP130 |
| interleukin 6 signal transducer |
| Anti-IL6ST |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 3572 |
| UniProt: | P40189 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IL6ST |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human plasma shows moderate positivity. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA010558-100ul |
|
|
HPA010558-100ul |
|
|
HPA010558-100ul |
Produktgarantie und fachkundiger Support
