Anti-IL6ST
Catalog Number:
ATA-HPA010558
- Images (8)
| Article Name: | Anti-IL6ST |
| Biozol Catalog Number: | ATA-HPA010558 |
| Supplier Catalog Number: | HPA010558 |
| Alternative Catalog Number: | ATA-HPA010558-100,ATA-HPA010558-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD130, GP130 |
| interleukin 6 signal transducer |
| Anti-IL6ST |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 3572 |
| UniProt: | P40189 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IL6ST |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human plasma shows moderate positivity. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA010558-100ul |
|
|
HPA010558-100ul |
|
|
HPA010558-100ul |
Product Guarantee and Expert Support
