Anti-FCGR2A
Artikelnummer:
ATA-HPA010718
- Bilder (8)
| Artikelname: | Anti-FCGR2A |
| Artikelnummer: | ATA-HPA010718 |
| Hersteller Artikelnummer: | HPA010718 |
| Alternativnummer: | ATA-HPA010718-100,ATA-HPA010718-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2 |
| Fc fragment of IgG, low affinity IIa, receptor (CD32) |
| Anti-FCGR2A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2212 |
| UniProt: | P12318 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FCGR2A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using Anti-FCGR2A antibody. Corresponding FCGR2A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FCGR2A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402871). |
|
|
HPA010718-100ul |
|
|
|
|
|
HPA010718-100ul |
|
|
HPA010718-100ul |
Produktgarantie und fachkundiger Support
