Anti-FCGR2A

Catalog Number: ATA-HPA010718
Article Name: Anti-FCGR2A
Biozol Catalog Number: ATA-HPA010718
Supplier Catalog Number: HPA010718
Alternative Catalog Number: ATA-HPA010718-100,ATA-HPA010718-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, IGFR2
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Anti-FCGR2A
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2212
UniProt: P12318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FCGR2A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using Anti-FCGR2A antibody. Corresponding FCGR2A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and FCGR2A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402871).
HPA010718-100ul
HPA010718-100ul
HPA010718-100ul