Anti-CDCP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010978
Artikelname: Anti-CDCP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010978
Hersteller Artikelnummer: HPA010978
Alternativnummer: ATA-HPA010978-100,ATA-HPA010978-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD318, SIMA135
CUB domain containing protein 1
Anti-CDCP1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 64866
UniProt: Q9H5V8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGSFCPGGSIKQIQVKQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDCP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human esophagus and lymph node tissues using Anti-CDCP1 antibody. Corresponding CDCP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA010978
HPA010978
HPA010978