Anti-CDCP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CDCP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA010978
• Supplier Catalog Number: HPA010978
• Alternative Catalog Number: ATA-HPA010978-100,ATA-HPA010978-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD318, SIMA135

Product Description

CUB domain containing protein 1

Additional Information

Anti-CDCP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 64866
• UniProt: Q9H5V8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGSFCPGGSIKQIQVKQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CDCP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human esophagus and lymph node tissues using Anti-CDCP1 antibody. Corresponding CDCP1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human esophagus shows high expression.

Immunohistochemical staining of human lymph node shows low expression as expected.

HPA010978

HPA010978

HPA010978