Anti-SIRT2
Artikelnummer:
ATA-HPA011165
- Bilder (8)
| Artikelname: | Anti-SIRT2 |
| Artikelnummer: | ATA-HPA011165 |
| Hersteller Artikelnummer: | HPA011165 |
| Alternativnummer: | ATA-HPA011165-100,ATA-HPA011165-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SIR2L |
| sirtuin 2 |
| Anti-SIRT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 22933 |
| UniProt: | Q8IXJ6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SIRT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in oligodendrocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in oligodendrocytes. |
|
|
HPA011165-100ul |
|
|
|
|
|
HPA011165-100ul |
|
|
HPA011165-100ul |
Produktgarantie und fachkundiger Support
