Anti-SIRT2
Catalog Number:
ATA-HPA011165
- Images (8)
| Article Name: | Anti-SIRT2 |
| Biozol Catalog Number: | ATA-HPA011165 |
| Supplier Catalog Number: | HPA011165 |
| Alternative Catalog Number: | ATA-HPA011165-100,ATA-HPA011165-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SIR2L |
| sirtuin 2 |
| Anti-SIRT2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 22933 |
| UniProt: | Q8IXJ6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SIRT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in oligodendrocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in oligodendrocytes. |
|
|
HPA011165-100ul |
|
|
|
|
|
HPA011165-100ul |
|
|
HPA011165-100ul |
Product Guarantee and Expert Support
