Anti-C1GALT1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA011294
Artikelname: Anti-C1GALT1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA011294
Hersteller Artikelnummer: HPA011294
Alternativnummer: ATA-HPA011294-100,ATA-HPA011294-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C1GALT, T-synthase
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Anti-C1GALT1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 56913
UniProt: Q9NS00
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: C1GALT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody HPA011294 (A) shows similar protein distribution across tissues to independent antibody HPA012819 (B).
Immunohistochemical staining of human kidney using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human liver using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human parathyroid gland using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human cerebral cortex using Anti-C1GALT1 antibody HPA011294.
Western blot analysis in human cell lines U2OS and HEK293 using Anti-C1GALT1 antibody. Corresponding C1GALT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA011294
HPA011294
HPA011294