Anti-C1GALT1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA011294
Article Name: Anti-C1GALT1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA011294
Supplier Catalog Number: HPA011294
Alternative Catalog Number: ATA-HPA011294-100,ATA-HPA011294-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1GALT, T-synthase
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Anti-C1GALT1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 56913
UniProt: Q9NS00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C1GALT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody HPA011294 (A) shows similar protein distribution across tissues to independent antibody HPA012819 (B).
Immunohistochemical staining of human kidney using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human liver using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human parathyroid gland using Anti-C1GALT1 antibody HPA011294.
Immunohistochemical staining of human cerebral cortex using Anti-C1GALT1 antibody HPA011294.
Western blot analysis in human cell lines U2OS and HEK293 using Anti-C1GALT1 antibody. Corresponding C1GALT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA011294
HPA011294
HPA011294