Anti-ZP2
Artikelnummer:
ATA-HPA011296
- Bilder (8)
| Artikelname: | Anti-ZP2 |
| Artikelnummer: | ATA-HPA011296 |
| Hersteller Artikelnummer: | HPA011296 |
| Alternativnummer: | ATA-HPA011296-100,ATA-HPA011296-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZPA |
| zona pellucida glycoprotein 2 (sperm receptor) |
| Anti-ZP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7783 |
| UniProt: | Q05996 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human ovary shows moderate cytoplasmic/ membranous positivity in oocytes. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
HPA011296-100ul |
|
|
HPA011296-100ul |
|
|
HPA011296-100ul |
Produktgarantie und fachkundiger Support
