Anti-ZP2
Catalog Number:
ATA-HPA011296
- Images (8)
| Article Name: | Anti-ZP2 |
| Biozol Catalog Number: | ATA-HPA011296 |
| Supplier Catalog Number: | HPA011296 |
| Alternative Catalog Number: | ATA-HPA011296-100,ATA-HPA011296-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ZPA |
| zona pellucida glycoprotein 2 (sperm receptor) |
| Anti-ZP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7783 |
| UniProt: | Q05996 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPAMQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human ovary shows moderate cytoplasmic/ membranous positivity in oocytes. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
HPA011296-100ul |
|
|
HPA011296-100ul |
|
|
HPA011296-100ul |
Product Guarantee and Expert Support
