Anti-SENP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA011765
Artikelname: Anti-SENP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA011765
Hersteller Artikelnummer: HPA011765
Alternativnummer: ATA-HPA011765-100,ATA-HPA011765-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SENP1
SUMO1/sentrin specific peptidase 1
Anti-SENP1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 29843
UniProt: Q9P0U3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SENP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in keratinocytes.
HPA011765
HPA011765
HPA011765