Anti-SENP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SENP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA011765
• Supplier Catalog Number: HPA011765
• Alternative Catalog Number: ATA-HPA011765-100,ATA-HPA011765-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SENP1

Product Description

SUMO1/sentrin specific peptidase 1

Additional Information

Anti-SENP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 29843
• UniProt: Q9P0U3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SENP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleus.

Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in keratinocytes.

HPA011765

HPA011765

HPA011765