Anti-SENP1

Catalog Number: ATA-HPA011765
Article Name: Anti-SENP1
Biozol Catalog Number: ATA-HPA011765
Supplier Catalog Number: HPA011765
Alternative Catalog Number: ATA-HPA011765-100,ATA-HPA011765-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SENP1
SUMO1/sentrin specific peptidase 1
Anti-SENP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 29843
UniProt: Q9P0U3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SENP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in keratinocytes.
HPA011765-100ul
HPA011765-100ul
HPA011765-100ul