Anti-PCDH7
Artikelnummer:
ATA-HPA011866
- Bilder (7)
| Artikelname: | Anti-PCDH7 |
| Artikelnummer: | ATA-HPA011866 |
| Hersteller Artikelnummer: | HPA011866 |
| Alternativnummer: | ATA-HPA011866-100,ATA-HPA011866-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BH-Pcdh, PPP1R120 |
| protocadherin 7 |
| Anti-PCDH7 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 5099 |
| UniProt: | O60245 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PCDH7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells. |
|
|
HPA011866-100ul |
|
|
HPA011866-100ul |
|
|
HPA011866-100ul |
Produktgarantie und fachkundiger Support
