Anti-PCDH7
Catalog Number:
ATA-HPA011866
- Images (7)
| Article Name: | Anti-PCDH7 |
| Biozol Catalog Number: | ATA-HPA011866 |
| Supplier Catalog Number: | HPA011866 |
| Alternative Catalog Number: | ATA-HPA011866-100,ATA-HPA011866-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BH-Pcdh, PPP1R120 |
| protocadherin 7 |
| Anti-PCDH7 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 5099 |
| UniProt: | O60245 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PCDH7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells. |
|
|
HPA011866-100ul |
|
|
HPA011866-100ul |
|
|
HPA011866-100ul |
Product Guarantee and Expert Support
