Anti-NEGR1

Artikelnummer: ATA-HPA011894
Artikelname: Anti-NEGR1
Artikelnummer: ATA-HPA011894
Hersteller Artikelnummer: HPA011894
Alternativnummer: ATA-HPA011894-100,ATA-HPA011894-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IGLON4, KILON, MGC46680, Ntra
neuronal growth regulator 1
Anti-NEGR1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 257194
UniProt: Q7Z3B1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NEGR1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Western blot analysis in human cerebral cortex tissue.
HPA011894-100ul
HPA011894-100ul
HPA011894-100ul