Anti-NEGR1

Catalog Number: ATA-HPA011894
Article Name: Anti-NEGR1
Biozol Catalog Number: ATA-HPA011894
Supplier Catalog Number: HPA011894
Alternative Catalog Number: ATA-HPA011894-100,ATA-HPA011894-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IGLON4, KILON, MGC46680, Ntra
neuronal growth regulator 1
Anti-NEGR1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 257194
UniProt: Q7Z3B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NEGR1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Western blot analysis in human cerebral cortex tissue.
HPA011894-100ul
HPA011894-100ul
HPA011894-100ul