Anti-SI Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA011897
Artikelname: Anti-SI Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA011897
Hersteller Artikelnummer: HPA011897
Alternativnummer: ATA-HPA011897-100,ATA-HPA011897-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SI
sucrase-isomaltase (alpha-glucosidase)
Anti-SI
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 6476
UniProt: P14410
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SI
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human small intestine and stomach tissues using HPA011897 antibody. Corresponding SI RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected.
HPA011897
HPA011897
HPA011897