Anti-SI Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA011897
- Images (9)
| Article Name: | Anti-SI Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA011897 |
| Supplier Catalog Number: | HPA011897 |
| Alternative Catalog Number: | ATA-HPA011897-100,ATA-HPA011897-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SI |
| sucrase-isomaltase (alpha-glucosidase) |
| Anti-SI |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6476 |
| UniProt: | P14410 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SI |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human small intestine and stomach tissues using HPA011897 antibody. Corresponding SI RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human stomach shows no positivity in glandular cells as expected. |
|
|
HPA011897 |
|
|
|
|
|
HPA011897 |
|
|
HPA011897 |
Product Guarantee and Expert Support
