Anti-ADAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012049
Artikelname: Anti-ADAP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012049
Hersteller Artikelnummer: HPA012049
Alternativnummer: ATA-HPA012049-100,ATA-HPA012049-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CENTA1, GCS1L
ArfGAP with dual PH domains 1
Anti-ADAP1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 11033
UniProt: O75689
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADAP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ADAP1 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, hippocampus, ovary and tonsil using Anti-ADAP1 antibody HPA012049 (A) shows similar protein distribution across tissues to independent antibody HPA007033 (B).
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human ovary using Anti-ADAP1 antibody HPA012049.
Immunohistochemical staining of human hippocampus using Anti-ADAP1 antibody HPA012049.
HPA012049
HPA012049
HPA012049