Anti-ADAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ADAP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA012049
• Supplier Catalog Number: HPA012049
• Alternative Catalog Number: ATA-HPA012049-100,ATA-HPA012049-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CENTA1, GCS1L

Product Description

ArfGAP with dual PH domains 1

Additional Information

Anti-ADAP1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 11033
• UniProt: O75689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ADAP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ADAP1 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, hippocampus, ovary and tonsil using Anti-ADAP1 antibody HPA012049 (A) shows similar protein distribution across tissues to independent antibody HPA007033 (B).

Immunohistochemical staining of human tonsil shows low expression as expected.

Immunohistochemical staining of human cerebral cortex shows high expression.

Immunohistochemical staining of human ovary using Anti-ADAP1 antibody HPA012049.

Immunohistochemical staining of human hippocampus using Anti-ADAP1 antibody HPA012049.

HPA012049

HPA012049

HPA012049