Anti-ADAP1

Catalog Number: ATA-HPA012049
Article Name: Anti-ADAP1
Biozol Catalog Number: ATA-HPA012049
Supplier Catalog Number: HPA012049
Alternative Catalog Number: ATA-HPA012049-100,ATA-HPA012049-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CENTA1, GCS1L
ArfGAP with dual PH domains 1
Anti-ADAP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 11033
UniProt: O75689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADAP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ADAP1 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, hippocampus, ovary and tonsil using Anti-ADAP1 antibody HPA012049 (A) shows similar protein distribution across tissues to independent antibody HPA007033 (B).
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human ovary using Anti-ADAP1 antibody HPA012049.
Immunohistochemical staining of human hippocampus using Anti-ADAP1 antibody HPA012049.
HPA012049-100ul
HPA012049-100ul
HPA012049-100ul