Anti-PARP14 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012063
Artikelname: Anti-PARP14 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012063
Hersteller Artikelnummer: HPA012063
Alternativnummer: ATA-HPA012063-100,ATA-HPA012063-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1268, pART8
poly (ADP-ribose) polymerase family, member 14
Anti-PARP14
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 54625
UniProt: Q460N5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PARP14
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human uterine cervix shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
HPA012063
HPA012063
HPA012063