Anti-PARP14 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012063
- Images (9)
| Article Name: | Anti-PARP14 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012063 |
| Supplier Catalog Number: | HPA012063 |
| Alternative Catalog Number: | ATA-HPA012063-100,ATA-HPA012063-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1268, pART8 |
| poly (ADP-ribose) polymerase family, member 14 |
| Anti-PARP14 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 54625 |
| UniProt: | Q460N5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PARP14 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human uterine cervix shows strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected. |
|
|
HPA012063 |
|
|
|
|
|
HPA012063 |
|
|
HPA012063 |
Product Guarantee and Expert Support
