Anti-TNIK Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012128
Artikelname: Anti-TNIK Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012128
Hersteller Artikelnummer: HPA012128
Alternativnummer: ATA-HPA012128-100,ATA-HPA012128-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0551
TRAF2 and NCK interacting kinase
Anti-TNIK
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23043
UniProt: Q9UKE5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TNIK
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemical staining of human upper gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows very weak cytoplasmic positivity in a small subset of squamous epithelial cells.
HPA012128
HPA012128
HPA012128