Anti-TNIK Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012128
- Images (9)
| Article Name: | Anti-TNIK Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012128 |
| Supplier Catalog Number: | HPA012128 |
| Alternative Catalog Number: | ATA-HPA012128-100,ATA-HPA012128-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0551 |
| TRAF2 and NCK interacting kinase |
| Anti-TNIK |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 23043 |
| UniProt: | Q9UKE5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TNIK |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows very weak cytoplasmic positivity in a small subset of squamous epithelial cells. |
|
|
HPA012128 |
|
|
|
|
|
HPA012128 |
|
|
HPA012128 |
Product Guarantee and Expert Support
