Anti-GRAMD1C
Artikelnummer:
ATA-HPA012316
- Bilder (8)
| Artikelname: | Anti-GRAMD1C |
| Artikelnummer: | ATA-HPA012316 |
| Hersteller Artikelnummer: | HPA012316 |
| Alternativnummer: | ATA-HPA012316-100,ATA-HPA012316-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp434C0328 |
| GRAM domain containing 1C |
| Anti-GRAMD1C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54762 |
| UniProt: | Q8IYS0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GRAMD1C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules and cells in glomeruli. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA012316-100ul |
|
|
|
|
|
HPA012316-100ul |
|
|
HPA012316-100ul |
Produktgarantie und fachkundiger Support
