Anti-GRAMD1C
Catalog Number:
ATA-HPA012316
- Images (8)
| Article Name: | Anti-GRAMD1C |
| Biozol Catalog Number: | ATA-HPA012316 |
| Supplier Catalog Number: | HPA012316 |
| Alternative Catalog Number: | ATA-HPA012316-100,ATA-HPA012316-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp434C0328 |
| GRAM domain containing 1C |
| Anti-GRAMD1C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 54762 |
| UniProt: | Q8IYS0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GRAMD1C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules and cells in glomeruli. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA012316-100ul |
|
|
|
|
|
HPA012316-100ul |
|
|
HPA012316-100ul |
Product Guarantee and Expert Support
