Anti-CD93 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012368
Artikelname: Anti-CD93 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012368
Hersteller Artikelnummer: HPA012368
Alternativnummer: ATA-HPA012368-100,ATA-HPA012368-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
CD93 molecule
Anti-CD93
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 22918
UniProt: Q9NPY3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD93
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA012368 antibody. Corresponding CD93 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, lung and skeletal muscle using Anti-CD93 antibody HPA012368 (A) shows similar protein distribution across tissues to independent antibody HPA009300 (B).
Immunohistochemical staining of human skeletal muscle shows moderate membranous positivity in endothelial cells, myocytes are negative.
Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.
Immunohistochemical staining of human colon shows strong membranous positivity in endothelial cells.
Immunohistochemical staining of human kidney shows strong membranous positivity in endothelial cells.
HPA012368
HPA012368
HPA012368