Anti-CD93 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012368
- Images (9)
| Article Name: | Anti-CD93 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012368 |
| Supplier Catalog Number: | HPA012368 |
| Alternative Catalog Number: | ATA-HPA012368-100,ATA-HPA012368-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4 |
| CD93 molecule |
| Anti-CD93 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 22918 |
| UniProt: | Q9NPY3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD93 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA012368 antibody. Corresponding CD93 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, lung and skeletal muscle using Anti-CD93 antibody HPA012368 (A) shows similar protein distribution across tissues to independent antibody HPA009300 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate membranous positivity in endothelial cells, myocytes are negative. |
|
|
Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in endothelial cells. |
|
|
HPA012368 |
|
|
HPA012368 |
|
|
HPA012368 |
Product Guarantee and Expert Support
