Anti-ENDOU Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012388
Artikelname: Anti-ENDOU Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012388
Hersteller Artikelnummer: HPA012388
Alternativnummer: ATA-HPA012388-25,ATA-HPA012388-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: P11, PP11, PRSS26
endonuclease, polyU-specific
Anti-ENDOU
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8909
UniProt: P21128
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ENDOU
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-ENDOU antibody. Corresponding ENDOU RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus, lymph node, skeletal muscle and testis using Anti-ENDOU antibody HPA012388 (A) shows similar protein distribution across tissues to independent antibody HPA067448 (B).
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-ENDOU antibody HPA012388.
Immunohistochemical staining of human testis using Anti-ENDOU antibody HPA012388.
HPA012388
HPA012388
HPA012388