Anti-ENDOU Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ENDOU Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA012388
• Supplier Catalog Number: HPA012388
• Alternative Catalog Number: ATA-HPA012388-25,ATA-HPA012388-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: P11, PP11, PRSS26

Product Description

endonuclease, polyU-specific

Additional Information

Anti-ENDOU

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 8909
• UniProt: P21128
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ENDOU
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-ENDOU antibody. Corresponding ENDOU RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human esophagus, lymph node, skeletal muscle and testis using Anti-ENDOU antibody HPA012388 (A) shows similar protein distribution across tissues to independent antibody HPA067448 (B).

Immunohistochemical staining of human esophagus shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human lymph node using Anti-ENDOU antibody HPA012388.

Immunohistochemical staining of human testis using Anti-ENDOU antibody HPA012388.

HPA012388

HPA012388

HPA012388