Anti-FBP1
Artikelnummer:
ATA-HPA012513
| Artikelname: |
Anti-FBP1 |
| Artikelnummer: |
ATA-HPA012513 |
| Hersteller Artikelnummer: |
HPA012513 |
| Alternativnummer: |
ATA-HPA012513-100,ATA-HPA012513-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FBP |
| fructose-1,6-bisphosphatase 1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
2203 |
| UniProt: |
P09467 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
FBP1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes. |
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages. |
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Skeletal muscle tissue |
|
HPA012513-100ul |
|
|
|
HPA012513-100ul |
|
HPA012513-100ul |