Anti-FBP1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012513
- Images (9)
| Article Name: | Anti-FBP1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012513 |
| Supplier Catalog Number: | HPA012513 |
| Alternative Catalog Number: | ATA-HPA012513-100,ATA-HPA012513-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FBP |
| fructose-1,6-bisphosphatase 1 |
| Anti-FBP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 2203 |
| UniProt: | P09467 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Skeletal muscle tissue |
|
|
HPA012513 |
|
|
|
|
|
HPA012513 |
|
|
HPA012513 |
Product Guarantee and Expert Support
