Anti-RHOT2
Artikelnummer:
ATA-HPA012624
- Bilder (8)
| Artikelname: | Anti-RHOT2 |
| Artikelnummer: | ATA-HPA012624 |
| Hersteller Artikelnummer: | HPA012624 |
| Alternativnummer: | ATA-HPA012624-100,ATA-HPA012624-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARHT2, C16orf39, MIRO-2 |
| ras homolog family member T2 |
| Anti-RHOT2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 89941 |
| UniProt: | Q8IXI1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RHOT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
HPA012624-100ul |
|
|
|
|
|
|
|
|
HPA012624-100ul |
|
|
HPA012624-100ul |
Produktgarantie und fachkundiger Support
