Anti-RHOT2
Catalog Number:
ATA-HPA012624
- Images (8)
| Article Name: | Anti-RHOT2 |
| Biozol Catalog Number: | ATA-HPA012624 |
| Supplier Catalog Number: | HPA012624 |
| Alternative Catalog Number: | ATA-HPA012624-100,ATA-HPA012624-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARHT2, C16orf39, MIRO-2 |
| ras homolog family member T2 |
| Anti-RHOT2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 89941 |
| UniProt: | Q8IXI1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RHOT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
HPA012624-100ul |
|
|
|
|
|
|
|
|
HPA012624-100ul |
|
|
HPA012624-100ul |
Product Guarantee and Expert Support
