Anti-PLA2R1

Artikelnummer: ATA-HPA012657
Artikelname: Anti-PLA2R1
Artikelnummer: ATA-HPA012657
Hersteller Artikelnummer: HPA012657
Alternativnummer: ATA-HPA012657-100,ATA-HPA012657-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLEC13C, PLA2-R, PLA2G1R, PLA2IR
phospholipase A2 receptor 1, 180kDa
Anti-PLA2R1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 22925
UniProt: Q13018
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLA2R1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and pancreas tissues using HPA012657 antibody. Corresponding PLA2R1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney (idiopathic membranous nephropathy) shows strong membranous positivity in cells in glomeruli.
Immunohistochemical staining of human kidney shows weak membranous positivity in cells in glomeruli.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Western blot analysis in human kidney tissue.
HPA012657-100ul
HPA012657-100ul
HPA012657-100ul