Anti-PLA2R1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012657
- Images (9)
| Article Name: | Anti-PLA2R1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012657 |
| Supplier Catalog Number: | HPA012657 |
| Alternative Catalog Number: | ATA-HPA012657-100,ATA-HPA012657-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLEC13C, PLA2-R, PLA2G1R, PLA2IR |
| phospholipase A2 receptor 1, 180kDa |
| Anti-PLA2R1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 22925 |
| UniProt: | Q13018 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLA2R1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and pancreas tissues using HPA012657 antibody. Corresponding PLA2R1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney (idiopathic membranous nephropathy) shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human kidney shows weak membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human kidney tissue. |
|
|
HPA012657 |
|
|
|
|
|
HPA012657 |
|
|
HPA012657 |
Product Guarantee and Expert Support
