Anti-NECTIN2
Artikelnummer:
ATA-HPA012759
- Bilder (8)
| Artikelname: | Anti-NECTIN2 |
| Artikelnummer: | ATA-HPA012759 |
| Hersteller Artikelnummer: | HPA012759 |
| Alternativnummer: | ATA-HPA012759-100,ATA-HPA012759-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD112, HVEB, PRR2, PVRL2, PVRR2 |
| nectin cell adhesion molecule 2 |
| Anti-NECTIN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5819 |
| UniProt: | Q92692 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NECTIN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA012759 antibody. Corresponding NECTIN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA012759-100ul |
|
|
HPA012759-100ul |
|
|
HPA012759-100ul |
Produktgarantie und fachkundiger Support
