Anti-NECTIN2
Catalog Number:
ATA-HPA012759
- Images (8)
| Article Name: | Anti-NECTIN2 |
| Biozol Catalog Number: | ATA-HPA012759 |
| Supplier Catalog Number: | HPA012759 |
| Alternative Catalog Number: | ATA-HPA012759-100,ATA-HPA012759-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD112, HVEB, PRR2, PVRL2, PVRR2 |
| nectin cell adhesion molecule 2 |
| Anti-NECTIN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5819 |
| UniProt: | Q92692 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NECTIN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA012759 antibody. Corresponding NECTIN2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA012759-100ul |
|
|
HPA012759-100ul |
|
|
HPA012759-100ul |
Product Guarantee and Expert Support
