Anti-PLD3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012800
Artikelname: Anti-PLD3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012800
Hersteller Artikelnummer: HPA012800
Alternativnummer: ATA-HPA012800-100,ATA-HPA012800-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HU-K4
phospholipase D family, member 3
Anti-PLD3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23646
UniProt: Q8IV08
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLD3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans.
Immunohistochemical staining of human skeletal muscle shows no granular cytoplasmic positivity in striated muscle fibers as expected.
Western blot analysis in human cell line SH-SY5Y.
HPA012800
HPA012800
HPA012800