Anti-PLD3 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA012800
- Images (9)
| Article Name: | Anti-PLD3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA012800 |
| Supplier Catalog Number: | HPA012800 |
| Alternative Catalog Number: | ATA-HPA012800-100,ATA-HPA012800-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HU-K4 |
| phospholipase D family, member 3 |
| Anti-PLD3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 23646 |
| UniProt: | Q8IV08 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLD3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans. |
|
|
Immunohistochemical staining of human skeletal muscle shows no granular cytoplasmic positivity in striated muscle fibers as expected. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA012800 |
|
|
|
|
|
HPA012800 |
|
|
HPA012800 |
Product Guarantee and Expert Support
