Anti-PLXDC1
Artikelnummer:
ATA-HPA012805
- Bilder (7)
| Artikelname: | Anti-PLXDC1 |
| Artikelnummer: | ATA-HPA012805 |
| Hersteller Artikelnummer: | HPA012805 |
| Alternativnummer: | ATA-HPA012805-100,ATA-HPA012805-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TEM3, TEM7 |
| plexin domain containing 1 |
| Anti-PLXDC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57125 |
| UniProt: | Q8IUK5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLXDC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colorectal cancer shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in endothelial cells of blood vessels and renal glomeruli. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. Endothelial cells are positive. |
|
|
HPA012805-100ul |
|
|
HPA012805-100ul |
|
|
HPA012805-100ul |
Produktgarantie und fachkundiger Support
