Anti-PLXDC1
Catalog Number:
ATA-HPA012805
- Images (7)
| Article Name: | Anti-PLXDC1 |
| Biozol Catalog Number: | ATA-HPA012805 |
| Supplier Catalog Number: | HPA012805 |
| Alternative Catalog Number: | ATA-HPA012805-100,ATA-HPA012805-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TEM3, TEM7 |
| plexin domain containing 1 |
| Anti-PLXDC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 57125 |
| UniProt: | Q8IUK5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLXDC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colorectal cancer shows strong membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in endothelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in endothelial cells of blood vessels and renal glomeruli. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. Endothelial cells are positive. |
|
|
HPA012805-100ul |
|
|
HPA012805-100ul |
|
|
HPA012805-100ul |
Product Guarantee and Expert Support
