Anti-STBD1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012849
Artikelname: Anti-STBD1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012849
Hersteller Artikelnummer: HPA012849
Alternativnummer: ATA-HPA012849-100,ATA-HPA012849-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ41801, GENX-3414
starch binding domain 1
Anti-STBD1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 8987
UniProt: O95210
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STBD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-STBD1 antibody. Corresponding STBD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, skeletal muscle, skin and testis using Anti-STBD1 antibody HPA012849 (A) shows similar protein distribution across tissues to independent antibody HPA011952 (B).
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Immunohistochemical staining of human testis using Anti-STBD1 antibody HPA012849.
Immunohistochemical staining of human colon using Anti-STBD1 antibody HPA012849.
HPA012849
HPA012849
HPA012849