Anti-STBD1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-STBD1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA012849
• Supplier Catalog Number: HPA012849
• Alternative Catalog Number: ATA-HPA012849-100,ATA-HPA012849-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ41801, GENX-3414

Product Description

starch binding domain 1

Additional Information

Anti-STBD1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 8987
• UniProt: O95210
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: APVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWW
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: STBD1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-STBD1 antibody. Corresponding STBD1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, skeletal muscle, skin and testis using Anti-STBD1 antibody HPA012849 (A) shows similar protein distribution across tissues to independent antibody HPA011952 (B).

Immunohistochemical staining of human skeletal muscle shows high expression.

Immunohistochemical staining of human skin shows low expression as expected.

Immunohistochemical staining of human testis using Anti-STBD1 antibody HPA012849.

Immunohistochemical staining of human colon using Anti-STBD1 antibody HPA012849.

HPA012849

HPA012849

HPA012849