Anti-RHOT2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012895
Artikelname: Anti-RHOT2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012895
Hersteller Artikelnummer: HPA012895
Alternativnummer: ATA-HPA012895-100,ATA-HPA012895-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARHT2, C16orf39, MIRO-2
ras homolog family member T2
Anti-RHOT2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 89941
UniProt: Q8IXI1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RHOT2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows cytoplasmic positivity.
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.
HPA012895
HPA012895
HPA012895